Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPA Recombinant Protein (Escherichia coli)

Product Specifications

CAS Number

9000-83-3

Gene Name

Murein tripeptide ABC transporter periplasmic binding protein

Gene Aliases

B1329; ECK1326; murein tripeptide ABC transporter periplasmic binding protein; ynaH.

Gene ID

945951

Accession Number

NP_415845

Reactivity

Escherichia coli

Target

Essential for the uptake of the murein peptide L-alanyl-gamma-D-glutamyl-meso-diaminopimelate. Also transports some alpha-linked peptides such as Pro-Phe-Lys with low affinity. The transport is effected by the oligopeptide permease system.

Type

Protein

Source

E.coli

Sequence

AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

73.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MppA

Protein Name

Periplasmic murein peptide-binding protein

Gene Name URL

MppA

Nucleotide Accession Number

NC_000913

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IRF1 Antibody Picoband®, Carrier-free
A00580-1-carrier-free 100 µg/Vial

Anti-IRF1 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Human GNL3L activation kit by CRISPRa
GA110176 1 Kit

Human GNL3L activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Slit Homolog 2 (Slit2)
TRV-0022531-01 200 µL

Biotin-Linked Polyclonal Antibody to Slit Homolog 2 (Slit2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Slit Homolog 2 (Slit2)
TRV-0022531-02 1 mL

Biotin-Linked Polyclonal Antibody to Slit Homolog 2 (Slit2)

Sign In for Pricing
View Details
Wilms tumor protein homolog
orb1645739-01 50 µg

Wilms tumor protein homolog

Sign In for Pricing
View Details
Wilms tumor protein homolog
orb1645739-02 100 µg

Wilms tumor protein homolog

Sign In for Pricing
View Details