Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHP Recombinant Protein (Staphylococcus aureus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

CHIPS.

Reactivity

Staphylococcus aureus

Target

Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP) . Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium (By similarity) .

Type

Protein

Source

Yeast

Sequence

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CHP

Protein Name

Chemotaxis inhibitory protein

Gene Name URL

CHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Smpdl3a shRNA (UAS) - Lentiviral mouse Smpdl3a shRNA (UAS) (25)
GTR15244877 1 Vial

Lentiviral mouse Smpdl3a shRNA (UAS) - Lentiviral mouse Smpdl3a shRNA (UAS) (25)

Sign In for Pricing
View Details
C3orf64 Rabbit Polyclonal Antibody (Biotin)
orb2113477 100 µL

C3orf64 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
STAM2 Antibody - N-terminal region
ARP75345_P050-25UL 25 µL

STAM2 Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal DOK2 Antibody (OTI1A4)
NBP2-00948 0.1 mL

Mouse Monoclonal DOK2 Antibody (OTI1A4)

Sign In for Pricing
View Details
CD83 Antibody
E313148b 200 µL

CD83 Antibody

Sign In for Pricing
View Details
Cyld 3'UTR Luciferase Stable Cell Line
TU203030 1.0 mL

Cyld 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details