Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXM1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Forkhead box M1

Gene Aliases

FKHL16; forkhead box M1-D; forkhead box protein M1; Forkhead, drosophila, homolog-like 16; forkhead-related protein FKHL16; FOXM1A; FOXM1B; FOXM1C; hepatocyte nuclear factor 3 forkhead homolog 11; HFH11; HFH-11; HNF-3; HNF-3/fork-head homolog 11; INS-1; M-phase phosphoprotein 2; MPHOSPH2; MPM-2 reactive phosphoprotein 2; MPP2; MPP-2; PIG29; transcription factor Trident; TRIDENT; winged-helix factor from INS-1 cells.

Gene ID

2305

Accession Number

NP_001230017

Reactivity

Homo sapiens|Human

Target

Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.

Type

Protein

Source

E.coli

Sequence

ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FOXM1

Protein Name

Forkhead box protein M1

Gene Name URL

FOXM1

Nucleotide Accession Number

NM_001243088

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A (Myocyte-Specific Enhancer Factor 2A, ADCAD1, MEF2, RSRFC4, RSRFC9)
353275 100 µg

MEF2A (Myocyte-Specific Enhancer Factor 2A, ADCAD1, MEF2, RSRFC4, RSRFC9)

Sign In for Pricing
View Details
CRYBB2 Rabbit Polyclonal Antibody
orb1176080 100 µg

CRYBB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SHMT1 Antibody Picoband® (monoclonal, 9C7)-FITC Conjugate
M02944-FITC 100 µg/Vial

Anti-SHMT1 Antibody Picoband® (monoclonal, 9C7)-FITC Conjugate

Sign In for Pricing
View Details
ADCY7 Protein Vector (Mouse) (pPB-N-His)
PV152615 500 ng

ADCY7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ABHD1 Antibody
GWB-MR777C 50 µg

ABHD1 Antibody

Sign In for Pricing
View Details
ANXA13 Antibody
orb518535-01 50 μL

ANXA13 Antibody

Sign In for Pricing
View Details