Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT83 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cancer/testis antigen 83

Gene Aliases

Cancer/testis antigen 83; CXorf61; kita-kyushu lung cancer antigen 1; KKLC1; KK-LC-1.

Gene ID

203413

Accession Number

NP_001017978

Reactivity

Homo sapiens|Human

Type

Protein

Source

Yeast

Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CT83

Protein Name

Kita-kyushu lung cancer antigen 1

Gene Name URL

CT83

Nucleotide Accession Number

NM_001017978

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB3A Protein Vector (Human) (pPM-C-HA)
PV100632 500 ng

MOB3A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GPR44 (PTGDR2) Human shRNA Plasmid Kit (Locus ID 11251)
TR316967 1 Kit

GPR44 (PTGDR2) Human shRNA Plasmid Kit (Locus ID 11251)

Sign In for Pricing
View Details
Human UL16 Binding protein 2 ELISA Kit
MBS740856-01 48 Strip Well (Competitive)

Human UL16 Binding protein 2 ELISA Kit

Sign In for Pricing
View Details
Human UL16 Binding protein 2 ELISA Kit
MBS740856-02 48 Strip Well (Sandwich)

Human UL16 Binding protein 2 ELISA Kit

Sign In for Pricing
View Details
Human UL16 Binding protein 2 ELISA Kit
MBS740856-03 96 Strip Well (Competitive)

Human UL16 Binding protein 2 ELISA Kit

Sign In for Pricing
View Details
Human UL16 Binding protein 2 ELISA Kit
MBS740856-04 96 Strip Well (Sandwich)

Human UL16 Binding protein 2 ELISA Kit

Sign In for Pricing
View Details