Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK8 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Kallikrein related-peptidase 8

Gene Aliases

Brain Serine protease 1; BS; BSP1; kallikrein-8; Neuropsin; NP; Nrpn; Pr; protease, serine, 19 (neuropsin) ; Prss19; Serine protease 19.

Gene ID

259277

Accession Number

NP_001311327

Reactivity

Mouse|Mus musculus

Target

Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.

Type

Protein

Source

Yeast

Sequence

ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Klk8

Protein Name

Kallikrein-8

Gene Name URL

Klk8

Nucleotide Accession Number

NM_001324398

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C-Reactive Protein Protein, His Tag
orb257363-01 250 µg

Human C-Reactive Protein Protein, His Tag

Sign In for Pricing
View Details
Human C-Reactive Protein Protein, His Tag
orb257363-02 1 mg

Human C-Reactive Protein Protein, His Tag

Sign In for Pricing
View Details
Ethyl maltol-d5
HY-W010320S 1 mg

Ethyl maltol-d5

Sign In for Pricing
View Details
Galactosidase Alpha (GLa) Monoclonal Antibody
CAU35026-01 100 µL

Galactosidase Alpha (GLa) Monoclonal Antibody

Sign In for Pricing
View Details
Galactosidase Alpha (GLa) Monoclonal Antibody
CAU35026-02 200 µL

Galactosidase Alpha (GLa) Monoclonal Antibody

Sign In for Pricing
View Details
Galactosidase Alpha (GLa) Monoclonal Antibody
CAU35026-03 1 mL

Galactosidase Alpha (GLa) Monoclonal Antibody

Sign In for Pricing
View Details