Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK8 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Kallikrein related-peptidase 8

Gene Aliases

Brain Serine protease 1; BS; BSP1; kallikrein-8; Neuropsin; NP; Nrpn; Pr; protease, serine, 19 (neuropsin) ; Prss19; Serine protease 19.

Gene ID

259277

Accession Number

NP_001311327

Reactivity

Mouse|Mus musculus

Target

Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.

Type

Protein

Source

Yeast

Sequence

ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Klk8

Protein Name

Kallikrein-8

Gene Name URL

Klk8

Nucleotide Accession Number

NM_001324398

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc7a12 AAV Vector (Mouse) (CMV)
44273104 1 µg

Slc7a12 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Nojirimycin-1-Sulfonic Acid
TRC-N635000-50MG 50 mg

Nojirimycin-1-Sulfonic Acid

Sign In for Pricing
View Details
GYPE (NM_198682) Human Over-expression Lysate
LC404804 20 µg

GYPE (NM_198682) Human Over-expression Lysate

Sign In for Pricing
View Details
LentimiRa-hsa-miR-191-5p Vector
mh40233 500 ng

LentimiRa-hsa-miR-191-5p Vector

Sign In for Pricing
View Details
Heptadecan-9-yl 6- (oxiran-2-yl) hexanoate
OR1005013 50 mg

Heptadecan-9-yl 6- (oxiran-2-yl) hexanoate

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Antibody
abx376529-01 50 µg

SARS-CoV-2 Spike NTD Antibody

Sign In for Pricing
View Details