Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A14 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A14

Gene Aliases

BCMP84; breast cancer membrane protein 84; protein S100-A14; S100 calcium-binding protein A14; S100A15; S114.

Gene ID

57402

Accession Number

NP_065723

Reactivity

Homo sapiens|Human

Target

Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.

Type

Protein

Source

E.coli

Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S100A14

Protein Name

Protein S100-A14

Gene Name URL

S100A14

Nucleotide Accession Number

NM_020672

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Art3-set siRNA/shRNA/RNAi Lentivector (Mouse)
12479094 4x 500 ng

Art3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
CD63 antibody
FNab10989 100 µg

CD63 antibody

Sign In for Pricing
View Details
1- (4-Fluorophenyl) -1,3-dihydro-3-oxo-5-isobenzofurancarbonitrile
sc-206107 2.5 mg

1- (4-Fluorophenyl) -1,3-dihydro-3-oxo-5-isobenzofurancarbonitrile

Sign In for Pricing
View Details
1- (Azetidin-3-yl) piperidine
T212314-01 10 mg

1- (Azetidin-3-yl) piperidine

Sign In for Pricing
View Details
1- (Azetidin-3-yl) piperidine
T212314-02 50 mg

1- (Azetidin-3-yl) piperidine

Sign In for Pricing
View Details
LAMA3 (NM_000227) Human Tagged ORF Clone Lentiviral Particle
RC215891L3V 200 µL

LAMA3 (NM_000227) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details