Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mago homolog, exon junction complex subunit

Gene Aliases

Mago homolog, exon junction complex core component; MAGOH1; MAGOHA; mago-nashi homolog, proliferation-associated; protein mago nashi homolog.

Gene ID

4116

Accession Number

NP_002361

Reactivity

Homo sapiens|Human

Target

Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD) . The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes) ; specifically inhibits formation of proapoptotic isoforms such as Bcl-X (S) ; the function is different from the established EJC assembly.

Type

Protein

Source

E.coli

Sequence

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MAGOH

Protein Name

Protein mago nashi homolog

Gene Name URL

MAGOH

Nucleotide Accession Number

NM_002370

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Adrenocorticotropic Hormone (ACTH) ELISA Kit
EKN49820 96 Tests

Bovine Adrenocorticotropic Hormone (ACTH) ELISA Kit

Ask
View Details
ZNF731 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51781151 3x 1.0 µg DNA

ZNF731 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Human RFX4 (NM_213594) AAV Particle
RC223334A1V 250 µL

Human RFX4 (NM_213594) AAV Particle

Ask
View Details
Human Antigen KI-67, MKI67 ELISA KIT
ELI-06573h 96 Tests

Human Antigen KI-67, MKI67 ELISA KIT

Ask
View Details