Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB18 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RAB18, member RAS oncogene family

Gene Aliases

RAB18 small GTPase; RAB18LI1; ras-related protein Rab-18; WARBM3.

Gene ID

22931

Accession Number

NP_001243339

Reactivity

Homo sapiens|Human

Target

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Type

Protein

Source

E.coli

Sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RAB18

Protein Name

Ras-related protein Rab-18

Gene Name URL

RAB18

Nucleotide Accession Number

NM_001256410

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDFY1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2627807 1.0 µg DNA

WDFY1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Factor Va Purified
IHUFVA250UG 1 Each

Human Factor Va Purified

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 650)
MBS6229514-01 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 650)

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 650)
MBS6229514-02 5x 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 650)

Sign In for Pricing
View Details
ADORA2A CRISPRa sgRNA lentivector (set of three targets)(Mouse)
11435124 3x 1.0µg DNA

ADORA2A CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
DMC1 (Disrupted Meiotic cDNA 1 Homolog, Disrupted Meiotic cDNA 1, Yeast Homolog of, DMC 1, DMC1, DMC1 Dosage Suppressor of Mck1 Homolog, DMC1 Dosage Suppressor of Mck1 Homolog Meiosis Specific Homologous Recombination (yeast), DMC1 Homologue) discontinued
376301 500 µg

DMC1 (Disrupted Meiotic cDNA 1 Homolog, Disrupted Meiotic cDNA 1, Yeast Homolog of, DMC 1, DMC1, DMC1 Dosage Suppressor of Mck1 Homolog, DMC1 Dosage Suppressor of Mck1 Homolog Meiosis Specific Homologous Recombination (yeast), DMC1 Homologue) discontinued

Sign In for Pricing
View Details