Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Actin related protein 2/3 complex subunit 5

Gene Aliases

Actin related protein 2/3 complex, subunit 5, 16kDa; actin-related protein 2/3 complex subunit 5; ARC16; arp2/3 complex 16 kDa subunit; Arp2/3 protein complex subunit p16; dJ127C7.3; p16-Arc.

Gene ID

10092

Accession Number

NP_001257368

Reactivity

Homo sapiens|Human

Target

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Type

Protein

Source

E.coli

Sequence

MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ARPC5

Protein Name

Actin-related protein 2/3 complex subunit 5

Gene Name URL

ARPC5

Nucleotide Accession Number

NM_001270439

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAAF1 Antibody Picoband®, FITC Conjugate
A12843-1-FITC 100 µg/Vial

Anti-PAAF1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)
CSB-EP5514CA (A4) (M)-01 20 µg

Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)

Sign In for Pricing
View Details
Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)
CSB-EP5514CA (A4) (M)-02 100 µg

Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)

Sign In for Pricing
View Details
Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)
CSB-EP5514CA (A4) (M)-03 1 mg

Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)

Sign In for Pricing
View Details
Lentiviral human KCNIP2 sgRNA gene knockout kit - Lentiviral human KCNIP2 sgRNA gene knockout kit (plasmid)
GTR15370121 1 Vial

Lentiviral human KCNIP2 sgRNA gene knockout kit - Lentiviral human KCNIP2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
IL13RA2, 27-343aa, Human, hIgG-His-tag, Baculovirus
MBS206690-01 0.01 mg

IL13RA2, 27-343aa, Human, hIgG-His-tag, Baculovirus

Sign In for Pricing
View Details