Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of inner mitochondrial membrane 23

Gene Aliases

Mitochondrial import inner membrane translocase subunit Tim23; TIM23; translocase of inner mitochondrial membrane 23 homolog; translocase of the inner mitochondrial membrane.

Gene ID

100287932

Accession Number

NP_006318

Reactivity

Homo sapiens|Human

Target

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Type

Protein

Source

E.coli

Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIMM23

Protein Name

Mitochondrial import inner membrane translocase subunit Tim23

Gene Name URL

TIMM23

Nucleotide Accession Number

NM_006327

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.X(Phospho-Ser139) Rabbit Polyclonal Antibody
MBS9402889-01 0.1 mL

Histone H2A.X(Phospho-Ser139) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2A.X(Phospho-Ser139) Rabbit Polyclonal Antibody
MBS9402889-02 5x 0.1 mL

Histone H2A.X(Phospho-Ser139) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(1-Propyl-piperidin-4-yl) -acetic acid
sc-303827 500 mg

(1-Propyl-piperidin-4-yl) -acetic acid

Sign In for Pricing
View Details
Kappa Light Chain (HCAK1, Ig Kappa Chain C Region, IGKC, Immunoglobulin KM) (PE)
168816-AF-PE 100 µL

Kappa Light Chain (HCAK1, Ig Kappa Chain C Region, IGKC, Immunoglobulin KM) (PE)

Sign In for Pricing
View Details
Anti-SMC1A Antibody Picoband® (Biotine Conjugate)
A02148-5-Biotin 100 µg/Vial

Anti-SMC1A Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) IBPB Polyclonal Antibody
MBS7169563 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) IBPB Polyclonal Antibody

Sign In for Pricing
View Details