Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHL3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Four and a half LIM domains 3

Gene Aliases

FHL-3; four and a half LIM domains protein 3; LIM-only protein FHL3; skeletal muscle LIM-protein 2; SLIM2; SLIM-2.

Gene ID

2275

Accession Number

NP_001230807

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FHL3

Protein Name

Four and a half LIM domains protein 3

Gene Name URL

FHL3

Nucleotide Accession Number

NM_001243878

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP 30 HDR Plasmid (m)
sc-425620-HDR 20 µg

SAP 30 HDR Plasmid (m)

Sign In for Pricing
View Details
TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: OTI3B6]
CF506583 100 µg

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

Sign In for Pricing
View Details
MYADM (NM_001290189) Human Tagged ORF Clone
RG237434 10 µg

MYADM (NM_001290189) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal EIG121 Antibody
NBP2-57699 100 µL

Rabbit Polyclonal EIG121 Antibody

Sign In for Pricing
View Details
BLK (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) APC
MBS6135525-01 0.1 mL

BLK (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) APC

Sign In for Pricing
View Details
BLK (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) APC
MBS6135525-02 5x 0.1 mL

BLK (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) APC

Sign In for Pricing
View Details