What is the catalog number for CPSF4 Recombinant Protein (Human)?

The catalog number for CPSF4 Recombinant Protein (Human) is OPCA05044-1MG.

What sizes are available for CPSF4 Recombinant Protein (Human)?

CPSF4 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is CPSF4 Recombinant Protein (Human) in stock?

CPSF4 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

CPSF4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cleavage and polyadenylation specific factor 4

Gene Aliases

Cleavage and polyadenylation specific factor 4, 30kDa; cleavage and polyadenylation specificity factor 30 kDa subunit; cleavage and polyadenylation specificity factor subunit 4; CPSF 30 kDa subunit; CPSF30; NAR; NEB1; NEB-1; no arches homolog; no arches-like zinc finger protein; NS1 effector domain-binding protein 1.

Gene ID

10898

Accession Number

NP_001075028

Reactivity

Homo sapiens|Human

Target

Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly (A) polymerase and other factors to bring about cleavage and poly (A) addition. CPSF4 binds RNA polymers with a preference for poly (U) .

Type

Protein

Source

E.coli

Sequence

MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.