Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Tubulin polymerization promoting protein

Gene Aliases

25 kDa brain-specific protein; brain specific protein p25 alpha; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24; p25; p25alpha; p25-alpha; TPPP/p25; TPPP1; tubulin polymerization-promoting protein.

Gene ID

11076

Accession Number

NP_008961

Reactivity

Homo sapiens|Human

Target

May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Type

Protein

Source

E.coli

Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TPPP

Protein Name

Tubulin polymerization-promoting protein

Gene Name URL

TPPP

Nucleotide Accession Number

NM_007030

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC7A14 shRNA (UAS) - Lentiviral human SLC7A14 shRNA (UAS, RFP) plasmid
GTR15307840 1 Vial

Lentiviral human SLC7A14 shRNA (UAS) - Lentiviral human SLC7A14 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Semenogelin I (SEMG1)
MBS2031820-01 0.01 mg

Recombinant Semenogelin I (SEMG1)

Sign In for Pricing
View Details
Recombinant Semenogelin I (SEMG1)
MBS2031820-02 0.05 mg

Recombinant Semenogelin I (SEMG1)

Sign In for Pricing
View Details
Recombinant Semenogelin I (SEMG1)
MBS2031820-03 0.1 mg

Recombinant Semenogelin I (SEMG1)

Sign In for Pricing
View Details
Recombinant Semenogelin I (SEMG1)
MBS2031820-04 0.2 mg

Recombinant Semenogelin I (SEMG1)

Sign In for Pricing
View Details
Recombinant Semenogelin I (SEMG1)
MBS2031820-05 0.5 mg

Recombinant Semenogelin I (SEMG1)

Sign In for Pricing
View Details