Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPM4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Tropomyosin 4

Gene Aliases

Epididymis secretory protein Li 108; HEL-S-108; TM30p1; tropomyosin alpha-4 chain; Tropomyosin-4.

Gene ID

7171

Accession Number

NP_001138632

Reactivity

Homo sapiens|Human

Target

Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments (By similarity) . Binds calcium (PubMed:1836432) .

Type

Protein

Source

E.coli

Sequence

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TPM4

Protein Name

Tropomyosin alpha-4 chain

Gene Name URL

TPM4

Nucleotide Accession Number

NM_001145160

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCO7 (TANGO6) (NM_024562) Human Over-expression Lysate
E45H12021-2 20 µg

TMCO7 (TANGO6) (NM_024562) Human Over-expression Lysate

Sign In for Pricing
View Details
Camk4, CT (Camk4, Calcium/calmodulin-dependent protein kinase type IV, CaM kinase-GR) (FITC) discontinued
033166-FITC 200 µL

Camk4, CT (Camk4, Calcium/calmodulin-dependent protein kinase type IV, CaM kinase-GR) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal FEN-1 Antibody (OTI1F3) [Alexa Fluor 488]
NBP2-70716AF488 0.1 mL

Mouse Monoclonal FEN-1 Antibody (OTI1F3) [Alexa Fluor 488]

Sign In for Pricing
View Details
Hs6st2 (NM_001077202) Mouse Tagged ORF Clone Lentiviral Particle
MR215964L4V 200 µL

Hs6st2 (NM_001077202) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BMP-2 (Animal Free)
200-002-L500-AF 500 µg

BMP-2 (Animal Free)

Sign In for Pricing
View Details
Recombinant Anti-MST1 Antibody, Rabbit Monoclonal
MBS8105394-01 0.1 mL

Recombinant Anti-MST1 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details