Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

SUMO1 activating enzyme subunit 1

Gene Aliases

Activator of SUMO1; AOS1; HSPC140; sentrin/SUMO-activating protein AOS1; SUA1; SUMO-1 activating enzyme E1 N subunit; SUMO-1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; ubiquitin-like 1-activating enzyme E1A; ubiquitin-like protein SUMO-1 activating enzyme; UBLE1A.

Gene ID

10055

Accession Number

NP_001139185

Reactivity

Homo sapiens|Human

Target

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.

Type

Protein

Source

E.coli

Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

65.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SAE1

Protein Name

SUMO-activating enzyme subunit 1

Gene Name URL

SAE1

Nucleotide Accession Number

NM_001145713

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD284 / TLR4 (TLR4/230), CF594 conjugate, 0.1mg/mL
BNC940230-100 1x 100 µL

CD284 / TLR4 (TLR4/230), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tbc1d7 Mouse Gene Knockout Kit (CRISPR)
KN317258 1 Kit

Tbc1d7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd5 Rat Monoclonal Antibody [Clone ID: 4H8E6]
AM08024RP-S 100 µg

Cd5 Rat Monoclonal Antibody [Clone ID: 4H8E6]

Sign In for Pricing
View Details
MCM2 Antibody
8C0259-AAT 50 µg

MCM2 Antibody

Sign In for Pricing
View Details
LAMP2 (NM_001122606) Human Recombinant Protein
TP720402 10 µg

LAMP2 (NM_001122606) Human Recombinant Protein

Sign In for Pricing
View Details
Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and Glycine
MSP09-500LT 500 L

Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and Glycine

Sign In for Pricing
View Details