Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mediator of cell motility 1

Gene Aliases

C21orf19-like protein; C2orf4; CGI-27; HCV NS5A-transactivated protein 7; hepatitis C virus NS5A-transactivated protein 7; mediator of ErbB2-driven cell motility 1; MEMO; NS5ATP7; protein MEMO1.

Gene ID

51072

Accession Number

NP_001131074

Reactivity

Homo sapiens|Human

Target

May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.

Type

Protein

Source

E.coli

Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MEMO1

Protein Name

Protein MEMO1

Gene Name URL

MEMO1

Nucleotide Accession Number

NM_001137602

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETNLB Polyclonal Antibody
MBS2525168-01 0.02 mL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
MBS2525168-02 0.06 mL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
MBS2525168-03 0.12 mL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
MBS2525168-04 0.2 mL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
CK8 Mouse Monoclonal Antibody
E12-078 100 µg -100 µL

CK8 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
RMI1 Peptide
DF12724-BP 1 mg

RMI1 Peptide

Sign In for Pricing
View Details