Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

F-box protein 2

Gene Aliases

FBG1; F-box gene 1; F-box only protein 2; Fbs1; FBX2; NFB42; OCP1; organ of Corti protein 1.

Gene ID

26232

Accession Number

NP_036300

Reactivity

Homo sapiens|Human

Target

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type (By similarity) .

Type

Protein

Source

E.coli

Sequence

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FBXO2

Protein Name

F-box only protein 2

Gene Name URL

FBXO2

Nucleotide Accession Number

NM_012168

More Discoveries

Explore Other Products

Browse additional items from our catalog

F5 ELISA Kit (Human)
OKCD06653-96W 96 Well

F5 ELISA Kit (Human)

Sign In for Pricing
View Details
Cckbr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6789205 3x 1.0 µg

Cckbr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Canine tissue inhibitors of metalloproteinase, TIMP1 ELISA Kit
ELA-E0552d 96 Tests

Canine tissue inhibitors of metalloproteinase, TIMP1 ELISA Kit

Sign In for Pricing
View Details
DTX1 AAV Vector (Human) (CMV)
18648101 1 µg

DTX1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Epoxide Hydrolase 2, Cytoplasmic (EPHX2) Antibody
abx112320 100 µL

Epoxide Hydrolase 2, Cytoplasmic (EPHX2) Antibody

Sign In for Pricing
View Details
Human MRPL51 activation kit by CRISPRa
GA109683 1 Kit

Human MRPL51 activation kit by CRISPRa

Sign In for Pricing
View Details