Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMM2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphomannomutase 2

Gene Aliases

CDG1; CDG1a; CDGS; mannose-6-phosphate isomerase; phosphomannomutase 2; phosphomannose isomerase 1; PMI; PMI1; PMM 2.

Gene ID

5373

Reactivity

Homo sapiens|Human

Target

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Type

Protein

Source

E.coli

Sequence

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PMM2

Protein Name

Phosphomannomutase 2

Gene Name URL

PMM2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mospd3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
30338114 3x 1.0 µg

Mospd3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RPTN Antibody - C-terminal region : FITC (ARP65825_P050-FITC)
ARP65825_P050-FITC 100 µL

RPTN Antibody - C-terminal region : FITC (ARP65825_P050-FITC)

Sign In for Pricing
View Details
Duck Nuclear Autoantigenic Sperm Protein (NASP) ELISA Kit
MBS9914061 Inquire

Duck Nuclear Autoantigenic Sperm Protein (NASP) ELISA Kit

Sign In for Pricing
View Details
Nkx2.5 Antibody
ASA-B1382 1 Each

Nkx2.5 Antibody

Sign In for Pricing
View Details
OR2A2 Protein Vector (Human) (pPM-C-His)
PV106397 500 ng

OR2A2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Canine Exocyst Complex Component 3-Like Protein (EXOC3L) ELISA Kit
MBS9930154-01 48 Well

Canine Exocyst Complex Component 3-Like Protein (EXOC3L) ELISA Kit

Sign In for Pricing
View Details