Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMM2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphomannomutase 2

Gene Aliases

CDG1; CDG1a; CDGS; mannose-6-phosphate isomerase; phosphomannomutase 2; phosphomannose isomerase 1; PMI; PMI1; PMM 2.

Gene ID

5373

Reactivity

Homo sapiens|Human

Target

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Type

Protein

Source

E.coli

Sequence

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PMM2

Protein Name

Phosphomannomutase 2

Gene Name URL

PMM2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sgsm1 Pre-designed siRNA Set B
SI212769B 1 Each

Rat Sgsm1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Phospho-AR/Androgen receptor (Tyr363) Polyclonal Antibody, Cy7 Conjugated
bs-12474R-Cy7 100 µL

Phospho-AR/Androgen receptor (Tyr363) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial
MBS7115115-01 0.01 mg

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial

Sign In for Pricing
View Details
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial
MBS7115115-02 0.05 mg

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial

Sign In for Pricing
View Details
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial
MBS7115115-03 0.5 mg

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial

Sign In for Pricing
View Details
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial
MBS7115115-04 1 mg

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial

Sign In for Pricing
View Details