Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCR10 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquinol-cytochrome c reductase, complex III subunit X

Gene Aliases

Complex III subunit 9; Complex III subunit X; cytochrome b-c1 complex subunit 9; cytochrome c1 non-heme 7 kDa protein; cytochrome C1, nonheme 7kDa protein; HSPC051; HSPC119; HSPC151; QCR9; ubiquinol-cytochrome c reductase complex (7.2 kD) ; ubiquinol-cytochrome c reductase complex 7.2 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa; UCCR7.2; UCRC.

Gene ID

29796

Accession Number

NP_001003684

Reactivity

Homo sapiens|Human

Target

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity) .

Type

Protein

Source

E.coli

Sequence

AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UQCR10

Protein Name

Cytochrome b-c1 complex subunit 9

Gene Name URL

UQCR10

Nucleotide Accession Number

NM_001003684

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protocadherin Beta-4 (PCDHB4) Antibody
abx037088-01 100 µg

Protocadherin Beta-4 (PCDHB4) Antibody

Sign In for Pricing
View Details
Protocadherin Beta-4 (PCDHB4) Antibody
abx037088-02 1 mg

Protocadherin Beta-4 (PCDHB4) Antibody

Sign In for Pricing
View Details
Benzyl butyl ether
B06320-01 5 g

Benzyl butyl ether

Sign In for Pricing
View Details
Benzyl butyl ether
B06320-02 25 g

Benzyl butyl ether

Sign In for Pricing
View Details
N-Nitroso rac bendroflumethiazide-d5
HY-W754427 50 mg

N-Nitroso rac bendroflumethiazide-d5

Sign In for Pricing
View Details
CHIT1 Rabbit pAb
E45R24545N 50 ul

CHIT1 Rabbit pAb

Sign In for Pricing
View Details