Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA12 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

NADH:ubiquinone oxidoreductase subunit A12

Gene Aliases

13 kDa differentiation-associated protein; B17.2; CI-B17.2; complex I B17.2 subunit; Complex I-B17.2; DAP13; MC1DN23; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; NADH-ubiquinone oxidoreductase subunit B17.2.

Gene ID

55967

Accession Number

NP_001245267

Reactivity

Homo sapiens|Human

Target

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Type

Protein

Source

E.coli

Sequence

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NDUFA12

Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

Gene Name URL

NDUFA12

Nucleotide Accession Number

NM_001258338

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK)
132041 100 µg

PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK)

Sign In for Pricing
View Details
HTR3B siRNA (Human)
MBS8207653-01 15 nmol

HTR3B siRNA (Human)

Sign In for Pricing
View Details
HTR3B siRNA (Human)
MBS8207653-02 30 nmol

HTR3B siRNA (Human)

Sign In for Pricing
View Details
HTR3B siRNA (Human)
MBS8207653-03 5x 30 nmol

HTR3B siRNA (Human)

Sign In for Pricing
View Details
GPRC6A Antibody
A21431-100UG 100 µg

GPRC6A Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD56 Antibody
JOT22916F 20Tests

FITC Anti-Human CD56 Antibody

Sign In for Pricing
View Details