Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5H Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

ATP synthase peripheral stalk subunit d

Gene Aliases

APT5H; ATP synthase D chain, mitochondrial; ATP synthase subunit d, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; ATP synthase, H+ transporting, mitochondrial Fo complex subunit D; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP5H; ATPase subunit d; ATPQ; My032 protein.

Gene ID

10476

Accession Number

NP_001003785

Reactivity

Homo sapiens|Human

Target

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha (3) beta (3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Type

Protein

Source

E.coli

Sequence

AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ATP5PD

Protein Name

ATP synthase subunit d, mitochondrial

Gene Name URL

ATP5PD

Nucleotide Accession Number

NM_001003785

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGR Protein Lysate
OCOA13889-20UG 20 µg

RGR Protein Lysate

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
bs-6842R-01 20 µL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details
JMJD6 Polyclonal Antibody
bs-6842R-02 100 µL

JMJD6 Polyclonal Antibody

Sign In for Pricing
View Details
Calretinin
AP81337 1 mg

Calretinin

Sign In for Pricing
View Details
Apolipoprotein E Recombinant Antibody, RBITC Conjugated
bsm-61226R-RBITC-01 20 µL

Apolipoprotein E Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Apolipoprotein E Recombinant Antibody, RBITC Conjugated
bsm-61226R-RBITC-02 100 µL

Apolipoprotein E Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details