Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM17B Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of inner mitochondrial membrane 17B

Gene Aliases

DXS9822; inner mitochondrial membrane preprotein translocase; JM3; mitochondrial import inner membrane translocase subunit Tim17-B; TIM17B; translocase of inner mitochondrial membrane 17 homolog B.

Gene ID

10245

Accession Number

NP_001161419

Reactivity

Homo sapiens|Human

Target

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Type

Protein

Source

E.coli

Sequence

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIMM17B

Protein Name

Mitochondrial import inner membrane translocase subunit Tim17-B

Gene Name URL

TIMM17B

Nucleotide Accession Number

NM_001167947

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[ (4-bromobenzene) amido]thiophene-3-carboxylic acid
sc-340689A 1 g

2-[ (4-bromobenzene) amido]thiophene-3-carboxylic acid

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)
MBS1280151-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)
MBS1280151-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)
MBS1280151-03 0.02 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)
MBS1280151-04 0.1 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)
MBS1280151-05 0.02 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Ribosome-recycling factor (frr)

Sign In for Pricing
View Details