Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Myosin light chain 1

Gene Aliases

A1 catalytic; A2 catalytic; MLC1/MLC3; MLC1F; MLC1F/MLC3F; MLC3F; MYOFTA; myosin light chain 1/3, skeletal muscle isoform; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast.

Gene ID

4632

Accession Number

NP_524144

Reactivity

Homo sapiens|Human

Target

Regulatory light chain of myosin. Does not bind calcium.

Type

Protein

Source

E.coli

Sequence

MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MYL1

Protein Name

Myosin light chain 1/3, skeletal muscle isoform

Gene Name URL

MYL1

Nucleotide Accession Number

NM_079420

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Superoxide Dismutases (SOD)
TRV-0063746-01 24 Tests

ELISA Kit for Superoxide Dismutases (SOD)

Sign In for Pricing
View Details
ELISA Kit for Superoxide Dismutases (SOD)
TRV-0063746-02 48 Tests

ELISA Kit for Superoxide Dismutases (SOD)

Sign In for Pricing
View Details
ELISA Kit for Superoxide Dismutases (SOD)
TRV-0063746-03 96 Tests

ELISA Kit for Superoxide Dismutases (SOD)

Sign In for Pricing
View Details
ELISA Kit for Superoxide Dismutases (SOD)
TRV-0063746-04 5x 96 Tests

ELISA Kit for Superoxide Dismutases (SOD)

Sign In for Pricing
View Details
ELISA Kit for Superoxide Dismutases (SOD)
TRV-0063746-05 10x 96 Tests

ELISA Kit for Superoxide Dismutases (SOD)

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rpsR Protein (aa 1-75) (strain ATCC 39315 / El Tor Inaba N16961)
VAng-Cr2904-50gEcoli 50 µg (E. coli)

Recombinant Vibrio Cholerae rpsR Protein (aa 1-75) (strain ATCC 39315 / El Tor Inaba N16961)

Sign In for Pricing
View Details