Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC19 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

DnaJ heat shock protein family (Hsp40) member C19

Gene Aliases

DnaJ (Hsp40) homolog, subfamily C, member 19; DnaJ homolog subfamily C member 19; DnaJ-like protein subfamily C member 19; homolog of yeast TIM14; mitochondrial import inner membrane translocase subunit TIM14; PAM18; TIM14; TIMM14.

Gene ID

131118

Accession Number

NP_001177162

Reactivity

Homo sapiens|Human

Target

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity) .

Type

Protein

Source

E.coli

Sequence

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DNAJC19

Protein Name

Mitochondrial import inner membrane translocase subunit TIM14

Gene Name URL

DNAJC19

Nucleotide Accession Number

NM_001190233

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A1 Antibody
DF6254-01 100 µL

Annexin A1 Antibody

Sign In for Pricing
View Details
Annexin A1 Antibody
DF6254-02 200 µL

Annexin A1 Antibody

Sign In for Pricing
View Details
Hectd2 ORF Vector (Mouse) (pORF)
ORF047081 1.0 µg DNA

Hectd2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
1- (4- (diethylamino) phenyl) ethanol
OR1098323 1 Each

1- (4- (diethylamino) phenyl) ethanol

Sign In for Pricing
View Details
6*His Monoclonal Antibody
CAC10284-01 50 µL

6*His Monoclonal Antibody

Sign In for Pricing
View Details
6*His Monoclonal Antibody
CAC10284-02 100 µL

6*His Monoclonal Antibody

Sign In for Pricing
View Details