Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDO1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cysteine dioxygenase type 1

Gene Aliases

CDO-I; cysteine dioxygenase type 1; Cysteine dioxygenase type I; cysteine dioxygenase, type I.

Gene ID

1036

Accession Number

NP_001310494

Reactivity

Homo sapiens|Human

Target

Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.

Type

Protein

Source

E.coli

Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDO1

Protein Name

Cysteine dioxygenase type 1

Gene Name URL

CDO1

Nucleotide Accession Number

NM_001323565

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERP shRNA Plasmid (m)
sc-75246-SH 20 µg

HERP shRNA Plasmid (m)

Sign In for Pricing
View Details
TFRC Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-41400R-PE-Cy5.5 100 µL

TFRC Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
WNT8B (NM_003393) Human Untagged Clone
SC118001 10 µg

WNT8B (NM_003393) Human Untagged Clone

Sign In for Pricing
View Details
Sodium Hydroxide Solution 4.0M (4.0N)
VM6655-E 1 L

Sodium Hydroxide Solution 4.0M (4.0N)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signaling Lymphocytic Activation Molecule Family, Member 1 (SLAMF1)
MBS2056382-01 0.1 mL

HRP-Linked Polyclonal Antibody to Signaling Lymphocytic Activation Molecule Family, Member 1 (SLAMF1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signaling Lymphocytic Activation Molecule Family, Member 1 (SLAMF1)
MBS2056382-02 0.2 mL

HRP-Linked Polyclonal Antibody to Signaling Lymphocytic Activation Molecule Family, Member 1 (SLAMF1)

Sign In for Pricing
View Details