Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS22 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mitochondrial ribosomal protein S22

Gene Aliases

28S ribosomal protein S22, mitochondrial; C3orf5; COXPD5; GIBT; GK002; mitochondrial small ribosomal subunit protein mS22; MRP-S22; ODG7; RPMS22; S22mt.

Gene ID

56945

Accession Number

NP_064576

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

68.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MRPS22

Protein Name

28S ribosomal protein S22, mitochondrial

Gene Name URL

MRPS22

Nucleotide Accession Number

NM_020191

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLQP-21 (Human) - FITC Labeled
FG-003-90B 1 nmol

TLQP-21 (Human) - FITC Labeled

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)
MBS1320754-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)
MBS1320754-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)
MBS1320754-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)
MBS1320754-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)
MBS1320754-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Riboflavin biosynthesis protein ribBA (ribBA)

Sign In for Pricing
View Details