Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonyl reductase 4

Gene Aliases

3-ketoacyl-[acyl-carrier-protein] reductase beta subunit;3-oxoacyl-[acyl-carrier-protein] reductase; carbonic reductase 4; carbonyl reductase family member 4; KAR beta subunit; quinone reductase CBR4; SDR45C1; short chain dehydrogenase/reductase family 45C member 1.

Gene ID

84869

Accession Number

NP_116172

Reactivity

Homo sapiens|Human

Target

The heterotetramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis (PubMed:19571038, PubMed:25203508) . Within the heterotetramer, HSD17B8 binds NADH; CBR4 binds NADPD (PubMed:25203508) . The homotetramer has NADPH-dependent quinone reductase activity (PubMed:19000905) . Both homotetramer and the heterotetramer have broad substrate specificity and can reduce 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro) (PubMed:19000905, PubMed:19571038, PubMed:25203508) .

Type

Protein

Source

E.coli

Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CBR4

Protein Name

Carbonyl reductase family member 4

Gene Name URL

CBR4

Nucleotide Accession Number

NM_032783

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Angio associated migory cell protein (AAMP) ELISA kit
GTR10372775 96 Well

Bovine Angio associated migory cell protein (AAMP) ELISA kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)
MBS1003185-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)
MBS1003185-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)
MBS1003185-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)
MBS1003185-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)
MBS1003185-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Protein shq1 (shq1)

Sign In for Pricing
View Details