Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB1L Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

G protein subunit beta 1 like

Gene Aliases

DGCRK3; FKSG1; g protein subunit beta-like protein 1; G-protein beta subunit-like protein; guanine nucleotide binding protein (G protein), beta polypeptide 1-like; guanine nucleotide binding protein beta-subunit-like polypeptide; guanine nucleotide-binding protein subunit beta-like protein 1; GY2; WD repeat-containing protein 14; WD40 repeat-containing protein deleted in VCFS; WDR14; WDVCF.

Gene ID

54584

Accession Number

NP_443730

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

62.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GNB1L

Protein Name

Guanine nucleotide-binding protein subunit beta-like protein 1

Gene Name URL

GNB1L

Nucleotide Accession Number

NM_053004

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGC Antibody
KC-32366-01 50 μL

PGC Antibody

Sign In for Pricing
View Details
PGC Antibody
KC-32366-02 100 µL

PGC Antibody

Sign In for Pricing
View Details
PGC Antibody
KC-32366-03 1 mL

PGC Antibody

Sign In for Pricing
View Details
ETHE1 Human Gene Knockout Kit (CRISPR)
KN402114 1 Kit

ETHE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ube2h Mouse Gene Knockout Kit (CRISPR)
KN518576 1 Kit

Ube2h Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PTEN Antibody
RC-16993-01 50 μL

Recombinant PTEN Antibody

Sign In for Pricing
View Details