Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIC2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cysteine rich hydrophobic domain 2

Gene Aliases

BRX-like translocated in leukemia; BTL; cysteine-rich hydrophobic domain 2 protein; cysteine-rich hydrophobic domain-containing protein 2; cystein-rich hydrophobic domain 2.

Gene ID

26511

Accession Number

NP_036242

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CHIC2

Protein Name

Cysteine-rich hydrophobic domain-containing protein 2

Gene Name URL

CHIC2

Nucleotide Accession Number

NM_012110

More Discoveries

Explore Other Products

Browse additional items from our catalog

OlFactory Receptor 8H2 (OR8H2) Human ELISA Kit
F5702 96 Tests

OlFactory Receptor 8H2 (OR8H2) Human ELISA Kit

Sign In for Pricing
View Details
1570-W Die-cut & Printed Numbers & Letters
097592 25 Pack (1 Label (s) x 25 Card)

1570-W Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
Tetratricopeptide Repeat Protein 3 (TPR Repeat Protein 3, TTC3, E3 Ubiquitin-protein Ligase TTC3, DCRR1, Protein DCRR1, RING Finger Protein 105, RNF105, TPR Repeat Protein D, TPRD, TPRDIII) (AP)
MBS6134364-01 0.1 mL

Tetratricopeptide Repeat Protein 3 (TPR Repeat Protein 3, TTC3, E3 Ubiquitin-protein Ligase TTC3, DCRR1, Protein DCRR1, RING Finger Protein 105, RNF105, TPR Repeat Protein D, TPRD, TPRDIII) (AP)

Sign In for Pricing
View Details
Tetratricopeptide Repeat Protein 3 (TPR Repeat Protein 3, TTC3, E3 Ubiquitin-protein Ligase TTC3, DCRR1, Protein DCRR1, RING Finger Protein 105, RNF105, TPR Repeat Protein D, TPRD, TPRDIII) (AP)
MBS6134364-02 5x 0.1 mL

Tetratricopeptide Repeat Protein 3 (TPR Repeat Protein 3, TTC3, E3 Ubiquitin-protein Ligase TTC3, DCRR1, Protein DCRR1, RING Finger Protein 105, RNF105, TPR Repeat Protein D, TPRD, TPRDIII) (AP)

Sign In for Pricing
View Details
(R) -2-Amino-3- ((4-hydroxy-2-methylbutan-2-yl) thio) propanoic acid
OR1063131-01 25 mg

(R) -2-Amino-3- ((4-hydroxy-2-methylbutan-2-yl) thio) propanoic acid

Sign In for Pricing
View Details
(R) -2-Amino-3- ((4-hydroxy-2-methylbutan-2-yl) thio) propanoic acid
OR1063131-02 50 mg

(R) -2-Amino-3- ((4-hydroxy-2-methylbutan-2-yl) thio) propanoic acid

Sign In for Pricing
View Details