Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAP29 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Synaptosome associated protein 29

Gene Aliases

CEDNIK; cerebral dysgenesis, neuropathy, ichthyosis and keratoderma syndrome; SNAP-29; soluble 29 kDa NSF attachment protein; synaptosomal-associated protein 29; synaptosomal-associated protein, 29kD; synaptosomal-associated protein, 29kDa; synaptosome associated protein 29kDa; vesicle-membrane fusion protein SNAP-29.

Gene ID

9342

Accession Number

NP_004773

Reactivity

Homo sapiens|Human

Target

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.

Type

Protein

Source

E.coli

Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

56 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SNAP29

Protein Name

Synaptosomal-associated protein 29

Gene Name URL

SNAP29

Nucleotide Accession Number

NM_004782

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Snail Homolog 1 (Drosophila) -Like 1 Protein (SNAIL1) ELISA Kit
MBS9904945 Inquire

Fish Snail Homolog 1 (Drosophila) -Like 1 Protein (SNAIL1) ELISA Kit

Sign In for Pricing
View Details
STARD7 Antibody
MBS8505526-01 0.1 mg

STARD7 Antibody

Sign In for Pricing
View Details
STARD7 Antibody
MBS8505526-02 0.1 mL (AF405L)

STARD7 Antibody

Sign In for Pricing
View Details
STARD7 Antibody
MBS8505526-03 0.1 mL (AF405S)

STARD7 Antibody

Sign In for Pricing
View Details
STARD7 Antibody
MBS8505526-04 0.1 mL (AF610)

STARD7 Antibody

Sign In for Pricing
View Details
STARD7 Antibody
MBS8505526-05 0.1 mL (AF635)

STARD7 Antibody

Sign In for Pricing
View Details