Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSPH Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphoserine phosphatase

Gene Aliases

L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; phosphoserine phosphatase; PSP; PSPase; PSPHD.

Gene ID

5723

Accession Number

NP_004568

Reactivity

Homo sapiens|Human

Target

Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.

Type

Protein

Source

E.coli

Sequence

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PSPH

Protein Name

Phosphoserine phosphatase

Gene Name URL

PSPH

Nucleotide Accession Number

NM_004577

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RBM5 Antibody
NBP1-83304-25ul 25 µL

Rabbit Polyclonal RBM5 Antibody

Sign In for Pricing
View Details
Human SLC39A13 ELISA Kit
E041576 1 Each

Human SLC39A13 ELISA Kit

Sign In for Pricing
View Details
Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit
ELK6837MS-01 48 Tests

Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit
ELK6837MS-02 96 Tests

Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit
ELK6837MS-03 5x 96 Tests

Mouse FFAR4 (Free Fatty Acid Receptor 4) Microsample ELISA Kit

Sign In for Pricing
View Details
Anti-GPR161 Antibody Picoband® (Biotine Conjugate)
A10567-1-Biotin 100 µg/Vial

Anti-GPR161 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details