Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCCS Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Holocytochrome c synthase

Gene Aliases

CCHL; cytochrome c heme-lyase; cytochrome c-type heme lyase; holocytochrome c-type synthase; holocytochrome-c synthetase; LSDMCA1; MCOPS7; microphthalamia with linear skin defects; microphthalmia with linear skin defects; MLS.

Gene ID

3052

Accession Number

NP_001116080

Reactivity

Homo sapiens|Human

Target

Links covalently the heme group to the apoprotein of cytochrome c.

Type

Protein

Source

E.coli

Sequence

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HCCS

Protein Name

Cytochrome c-type heme lyase

Gene Name URL

HCCS

Nucleotide Accession Number

NM_001122608

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLBP CRISPR Activation Plasmid (h)
sc-403637-ACT 20 µg

SLBP CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Oxetan-3-yl methanesulfonate
YFA43081-01 1 g

Oxetan-3-yl methanesulfonate

Sign In for Pricing
View Details
Oxetan-3-yl methanesulfonate
YFA43081-02 10 g

Oxetan-3-yl methanesulfonate

Sign In for Pricing
View Details
EIF2C1 shRNA (m) Lentiviral Particles
sc-44647-V 200 µL

EIF2C1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
FAM49B CRISPR Activation Plasmid (h2)
sc-409946-ACT-2 20 µg

FAM49B CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (AP) discontinued
123139-AP 100 µL

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (AP) discontinued

Sign In for Pricing
View Details