Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase 1 regulatory subunit 8

Gene Aliases

Activator of RNA decay; ARD1; ARD-1; NIPP1; NIPP-1; nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; nuclear inhibitor of protein phosphatase-1 beta; nuclear subunit of PP-1; PRO2047; Protein phosphatase 1 regulatory inhibitor subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; RNase E.

Gene ID

5511

Accession Number

NP_002704

Reactivity

Homo sapiens|Human

Target

Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1) . It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.

Type

Protein

Source

E.coli

Sequence

MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPP1R8

Protein Name

Nuclear inhibitor of protein phosphatase 1

Gene Name URL

PPP1R8

Nucleotide Accession Number

NM_002713

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin (MaxLight 490) discontinued
I7656-01B-ML490 100 µL

Insulin (MaxLight 490) discontinued

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)
MBS2035886-01 0.1 mL

PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)
MBS2035886-02 0.2 mL

PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)
MBS2035886-03 0.5 mL

PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)
MBS2035886-04 1 mL

PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)
MBS2035886-05 5 mL

PE-Linked Polyclonal Antibody to Glycoprotein 130 (gp130)

Sign In for Pricing
View Details