Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEA15 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Proliferation and apoptosis adaptor protein 15

Gene Aliases

15 kDa phosphoprotein enriched in astrocytes; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT-1 oncogene; HUMMAT1H; mammary transforming gene 1, mouse, homolog of; MAT1; MAT1H; PEA-15; PED; PED/PEA15; PED-PEA15; phosphoprotein enriched in astrocytes 15; phosphoprotein enriched in diabetes; proliferation and apoptosis adaptor 15.

Gene ID

8682

Accession Number

NP_001284505

Reactivity

Homo sapiens|Human

Target

Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity) . Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.

Type

Protein

Source

E.coli

Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PEA15

Protein Name

Astrocytic phosphoprotein PEA-15

Gene Name URL

PEA15

Nucleotide Accession Number

NM_001297576

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RDX (Radixin, DFNB24) (MaxLight 490)
251022-ML490 100 µL

RDX (Radixin, DFNB24) (MaxLight 490)

Sign In for Pricing
View Details
ATP6V1C2 Human siRNA Oligo Duplex (Locus ID 245973)
SR316715 1 Kit

ATP6V1C2 Human siRNA Oligo Duplex (Locus ID 245973)

Sign In for Pricing
View Details
GATA3 Antibody
E033160 100 µg -100 µL

GATA3 Antibody

Sign In for Pricing
View Details
Polyclonal PKD1 (aa2281-2292) Antibody (C-Term)
AMR09305G 0.1 mg

Polyclonal PKD1 (aa2281-2292) Antibody (C-Term)

Sign In for Pricing
View Details
USO1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
49270151 3x 1.0 µg DNA

USO1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (AP) discontinued
244570-AP 100 µL

CDX4 (Caudal Type Homeobox 4) (AP) discontinued

Sign In for Pricing
View Details