Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHDDS Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dehydrodolichyl diphosphate synthase subunit

Gene Aliases

Cis-IPTase; cis-isoprenyltransferase; cis-prenyl transferase; cis-prenyltransferase subunit hCIT; CIT; CPT; dedol-PP synthase; DEDSM; dehydrodolichyl diphosphate syntase complex subunit DHDDS; dehydrodolichyl diphosphate synthase complex subunit DHDDS; DS; epididymis tissue protein Li 189m; hCIT; HDS; RP59.

Gene ID

79947

Accession Number

NP_001230493

Reactivity

Homo sapiens|Human

Target

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) . Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.

Type

Protein

Source

E.coli

Sequence

MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

65.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DHDDS

Protein Name

Dehydrodolichyl diphosphate synthase complex subunit DHDDS

Gene Name URL

DHDDS

Nucleotide Accession Number

NM_001243564

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSRNP2 shRNA Plasmid
abx963001-01 150 µg

Human CSRNP2 shRNA Plasmid

Sign In for Pricing
View Details
Human CSRNP2 shRNA Plasmid
abx963001-02 300 µg

Human CSRNP2 shRNA Plasmid

Sign In for Pricing
View Details
TSPAN2 (Center) Rabbit pAb
MBS8555472-01 0.1 mL

TSPAN2 (Center) Rabbit pAb

Sign In for Pricing
View Details
TSPAN2 (Center) Rabbit pAb
MBS8555472-02 0.1 mL (AF405L)

TSPAN2 (Center) Rabbit pAb

Sign In for Pricing
View Details
TSPAN2 (Center) Rabbit pAb
MBS8555472-03 0.1 mL (AF405S)

TSPAN2 (Center) Rabbit pAb

Sign In for Pricing
View Details
TSPAN2 (Center) Rabbit pAb
MBS8555472-04 0.1 mL (AF610)

TSPAN2 (Center) Rabbit pAb

Sign In for Pricing
View Details