Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Inhibition of the Dvl and axin complex protein.

Reactivity

Homo sapiens|Human

Target

Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Type

Protein

Source

E.coli

Sequence

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXXC4

Protein Name

CXXC-type zinc finger protein 4

Gene Name URL

CXXC4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein
TP301992 20 µg

GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein

Sign In for Pricing
View Details
Puromycin dihydrochloride
sc-108071C 1 g

Puromycin dihydrochloride

Sign In for Pricing
View Details
GLUDP4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
58087151 3x 1.0 µg DNA

GLUDP4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
CLC-3 Lentiviral Activation Particles (h2)
sc-402781-LAC-2 200 µL

CLC-3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
GREB1L HDR Plasmid (m)
sc-436245-HDR 20 µg

GREB1L HDR Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal RNPEPL1 Antibody (4D12) [DyLight 488]
NBP2-59372G 100 µL

Mouse Monoclonal RNPEPL1 Antibody (4D12) [DyLight 488]

Sign In for Pricing
View Details