Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Inhibition of the Dvl and axin complex protein.

Reactivity

Homo sapiens|Human

Target

Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Type

Protein

Source

E.coli

Sequence

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXXC4

Protein Name

CXXC-type zinc finger protein 4

Gene Name URL

CXXC4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF2, ID (HSF2, HSTF2, Heat shock factor protein 2, Heat shock transcription factor 2)
036790 200 µL

HSF2, ID (HSF2, HSTF2, Heat shock factor protein 2, Heat shock transcription factor 2)

Sign In for Pricing
View Details
MPHOSPH9 Human shRNA Plasmid Kit (Locus ID 10198)
TR303196 1 Kit

MPHOSPH9 Human shRNA Plasmid Kit (Locus ID 10198)

Sign In for Pricing
View Details
Vgll1 ORF Vector (Mouse) (pORF)
49494014 1.0 µg DNA

Vgll1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
NFATC4 antibody - N-terminal region
MBS3200724-01 0.1 mL

NFATC4 antibody - N-terminal region

Sign In for Pricing
View Details
NFATC4 antibody - N-terminal region
MBS3200724-02 5x 0.1 mL

NFATC4 antibody - N-terminal region

Sign In for Pricing
View Details
3-Aminorifamycin S
423985-01 10 mg

3-Aminorifamycin S

Sign In for Pricing
View Details