Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Inhibition of the Dvl and axin complex protein.

Reactivity

Homo sapiens|Human

Target

Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Type

Protein

Source

E.coli

Sequence

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXXC4

Protein Name

CXXC-type zinc finger protein 4

Gene Name URL

CXXC4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PELO 3'UTR Luciferase Stable Cell Line
TU017728 1.0 mL

PELO 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human ACE-2 His-tag Alexa Fluor 488 Protein
AFG933-020 20 µg

Recombinant Human ACE-2 His-tag Alexa Fluor 488 Protein

Sign In for Pricing
View Details
Olfr739 Lentiviral Activation Particles (m)
sc-434785-LAC 200 µL

Olfr739 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Pdpr sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4970602 1.0 µg DNA

Pdpr sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Myosin Light Chain Kinase, Smooth Muscle, NT (smMLCK, MLCK, MLCK1, MLCK108, MLCK210, MYLK, MYLK1, DKFZp686I10125, FLJ12216, Kinase-related Protein, KRP, MSTP083, Telokin) (MaxLight 405) discontinued
M9850-07E-ML405 100 µL

Myosin Light Chain Kinase, Smooth Muscle, NT (smMLCK, MLCK, MLCK1, MLCK108, MLCK210, MYLK, MYLK1, DKFZp686I10125, FLJ12216, Kinase-related Protein, KRP, MSTP083, Telokin) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-CDKL4 Antibody
MBS4506742-01 0.05 mL

Rabbit anti-CDKL4 Antibody

Sign In for Pricing
View Details