Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Recombinant Protein (Human)

Product Specifications

Gene Name

SPT4 homolog, DSIF elongation factor subunit

Gene Aliases

DRB sensitivity-inducing factor 14 kDa subunit; DRB sensitivity-inducing factor small subunit; DSIF p14; small hSpt4 subunit; SPT4; SPT4H; suppressor of Ty 4 homolog 1; Supt4a; SUPT4H; transcription elongation factor SPT4.

Gene ID

6827

Accession Number

NP_003159

Reactivity

Homo sapiens|Human

Target

Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.

Type

Protein

Source

E.coli

Sequence

ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SUPT4H1

Protein Name

Transcription elongation factor SPT4

Gene Name URL

SUPT4H1

CAS Number

9000-83-3

Nucleotide Accession Number

NM_003168

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CXCL7/Thymus Chemokine-1 MAb (Clone 159742)
MAB1091-SP 25 µg

Mouse CXCL7/Thymus Chemokine-1 MAb (Clone 159742)

Ask
View Details
Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)
MBS1485562-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)

Ask
View Details
Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)
MBS1485562-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)

Ask
View Details
Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)
MBS1485562-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)

Ask
View Details
Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)
MBS1485562-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)

Ask
View Details
Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)
MBS1485562-05 0.02 mg (Baculovirus)

Recombinant Synechococcus sp. Glycine--tRNA ligase alpha subunit (glyQ)

Ask
View Details