Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB31 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RAB31, member RAS oncogene family

Gene Aliases

Rab22B; ras-related protein Rab-22B; ras-related protein Rab-31.

Gene ID

11031

Accession Number

NP_006859

Reactivity

Homo sapiens|Human

Target

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Type

Protein

Source

E.coli

Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RAB31

Protein Name

Ras-related protein Rab-31

Gene Name URL

RAB31

Nucleotide Accession Number

NM_006868

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARMIL1 Antibody (Biotin)
orb516692-01 50 µg

CARMIL1 Antibody (Biotin)

Sign In for Pricing
View Details
CARMIL1 Antibody (Biotin)
orb516692-02 100 µg

CARMIL1 Antibody (Biotin)

Sign In for Pricing
View Details
TNFRSF4 Antibody
MBS7117787-01 0.05 mg

TNFRSF4 Antibody

Sign In for Pricing
View Details
TNFRSF4 Antibody
MBS7117787-02 0.1 mg

TNFRSF4 Antibody

Sign In for Pricing
View Details
TNFRSF4 Antibody
MBS7117787-03 5x 0.1 mg

TNFRSF4 Antibody

Sign In for Pricing
View Details
CTDSP1 polyclonal antibody
orb752177-01 25 µL

CTDSP1 polyclonal antibody

Sign In for Pricing
View Details