Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U2AF1L4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

U2 small nuclear RNA auxiliary factor 1 like 4

Gene Aliases

Splicing factor U2AF 26 kDa subunit; U2 auxiliary factor 26; U2 small nuclear RNA auxiliary factor 1-like 3; U2 small nuclear RNA auxiliary factor 1-like protein 3; U2 small nuclear RNA auxiliary factor 1-like protein 4; U2 (RNU2) small nuclear RNA auxiliary factor 1-like 3; U2 (RNU2) small nuclear RNA auxiliary factor 1-like protein 3; U2AF1L3; U2AF1L3V1; U2AF1-like 4; U2AF1-like protein 3; U2AF1RS3; U2AF1-RS3; U2af26.

Gene ID

199746

Accession Number

NP_001035515

Reactivity

Homo sapiens|Human

Target

RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participates in the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site (By similarity) . Shows a preference for AGC or AGA (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49 kDa

Protein Length

Recombinant

NCBI Gene Symbol

U2AF1L4

Protein Name

Splicing factor U2AF 26 kDa subunit

Gene Name URL

U2AF1L4

Nucleotide Accession Number

NM_001040425

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CHEK1 (Ser296) Polyclonal Antibody, Cy5 Conjugated
bs-11226R-Cy5 100 µL

Phospho-CHEK1 (Ser296) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
CLPP Rabbit Monoclonal Antibody
AMRe84414-01 1 Each

CLPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CLPP Rabbit Monoclonal Antibody
AMRe84414-02 50 µL

CLPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CLPP Rabbit Monoclonal Antibody
AMRe84414-03 100 µL

CLPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRIM11 Lentiviral Activation Particles (m2)
sc-430109-LAC-2 200 µL

TRIM11 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
MBL1P Protein Vector (Human) (pPB-N-His)
PV093459 500 ng

MBL1P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details