Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIAP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TP53 regulated inhibitor of apoptosis 1

Gene Aliases

HSPC132; MDM35; mitochondrial distribution and morphology 35 homolog; P53CSV; p53-inducible cell-survival factor; protein 15E1.1; TP53-regulated inhibitor of apoptosis 1; WF-1.

Gene ID

51499

Accession Number

NP_057483

Reactivity

Homo sapiens|Human

Target

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed:23931759) . Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed:26071602) . Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed:15735003) .

Type

Protein

Source

E.coli

Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TRIAP1

Protein Name

TP53-regulated inhibitor of apoptosis 1

Gene Name URL

TRIAP1

Nucleotide Accession Number

NM_016399

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENaC alpha Antibody, Clone 2G4: ATTO 488
SMC-239D-A488 100 µg

ENaC alpha Antibody, Clone 2G4: ATTO 488

Sign In for Pricing
View Details
Serpinb8 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3166504 1.0 µg DNA

Serpinb8 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
pENTR223-TSPAN5 Plasmid
PVT12719 2 µg

pENTR223-TSPAN5 Plasmid

Sign In for Pricing
View Details
EXOSC10 (NM_001001998) Human Tagged ORF Clone Lentiviral Particle
RC210055L1V 200 µL

EXOSC10 (NM_001001998) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Guanylate-Binding Protein 3 (GBP3) ELISA Kit
MBS9391069 Inquire

Rabbit Guanylate-Binding Protein 3 (GBP3) ELISA Kit

Sign In for Pricing
View Details
PCAF (PCAF) Antibody
abx008477-01 30 µL

PCAF (PCAF) Antibody

Sign In for Pricing
View Details