Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP22 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dual specificity phosphatase 22

Gene Aliases

Dual specificity protein phosphatase 22; epididymis secretory sperm binding protein; homolog of mouse dual specificity phosphatase LMW-DSP2; JKAP; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; JSP1; JSP-1; LMWDSP2; LMW-DSP2; low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; mitogen-activated protein kinase phosphatase x; MKP-x; MKPX; VHX.

Gene ID

56940

Accession Number

NP_001273484

Reactivity

Homo sapiens|Human

Target

Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity) .

Type

Protein

Source

E.coli

Sequence

GNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DUSP22

Protein Name

Dual specificity protein phosphatase 22

Gene Name URL

DUSP22

Nucleotide Accession Number

NM_001286555

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCGBP Rabbit pAb
E47R13168 100 µL

FCGBP Rabbit pAb

Sign In for Pricing
View Details
LAT Protein Vector (Mouse) (pPM-C-HA)
26325024 500 ng

LAT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) NRAT1 Polyclonal Antibody
MBS7197029 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) NRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
LDB1 Antibody
28-731 100 µL

LDB1 Antibody

Sign In for Pricing
View Details
Trim40 (NM_001172168) Mouse Tagged Lenti ORF Clone
MR216518L3 10 µg

Trim40 (NM_001172168) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-STAT1 (Ser727) Rabbit mAb, 1 pack = 20 µL
BAL1563 1 Each

Phospho-STAT1 (Ser727) Rabbit mAb, 1 pack = 20 µL

Sign In for Pricing
View Details