Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAS2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RAS related 2

Gene Aliases

NS12; ras-like protein TC21; ras-related protein R-Ras2; related RAS viral (r-ras) oncogene homolog 2; TC21; teratocarcinoma oncogene.

Gene ID

22800

Accession Number

NP_001096139

Reactivity

Homo sapiens|Human

Target

It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.

Type

Protein

Source

E.coli

Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RRAS2

Protein Name

Ras-related protein R-Ras2

Gene Name URL

RRAS2

Nucleotide Accession Number

NM_001102669

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf183 (LINC01599) Human Gene Knockout Kit (CRISPR)
KN414759 1 Kit

C14orf183 (LINC01599) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody
abx007257-01 20 µL

UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody

Sign In for Pricing
View Details
UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody
abx007257-02 100 µL

UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody

Sign In for Pricing
View Details
UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody
abx007257-03 2x 100 µL

UV Excision Repair Protein RAD23 Homolog B (RAD23B) Antibody

Sign In for Pricing
View Details
Sheep Olfactory receptor 10J3 (OR10J3) ELISA Kit
GTR10358571 96 Well

Sheep Olfactory receptor 10J3 (OR10J3) ELISA Kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Vanin 1 (VNN1)
MBS2066991-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Vanin 1 (VNN1)

Sign In for Pricing
View Details