Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Regulator of G protein signaling 5

Gene Aliases

MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; regulator of G-protein signaling 5.

Gene ID

8490

Accession Number

NP_001182232

Reactivity

Homo sapiens|Human

Target

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G (i) -alpha and G (o) -alpha, but not to G (s) -alpha (By similarity) .

Type

Protein

Source

E.coli

Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RGS5

Protein Name

Regulator of G-protein signaling 5

Gene Name URL

RGS5

Nucleotide Accession Number

NM_001195303

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit
MBS2161643-01 96 Tests

Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit
MBS2161643-02 5x 96 Tests

Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit
MBS2161643-03 10x 96 Tests

Transmembrane Protein 106B (TMEM106B) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida lolB Protein (aa 19-194)
VAng-Lsx1119-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Salmonicida lolB Protein (aa 19-194)

Sign In for Pricing
View Details
Rabbit Immunoglobulin A (IgA) ELISA Kit
orb2668149-01 48 Tests

Rabbit Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Immunoglobulin A (IgA) ELISA Kit
orb2668149-02 96 Tests

Rabbit Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details