Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Programmed cell death 5

Gene Aliases

Programmed cell death protein 5; TF1 cell apoptosis-related gene 19; TF-1 cell apoptosis-related protein 19; TFAR19; TFAR19 novel apoptosis-related.

Gene ID

9141

Accession Number

NP_004699

Reactivity

Homo sapiens|Human

Target

May function in the process of apoptosis.

Type

Protein

Source

E.coli

Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PDCD5

Protein Name

Programmed cell death protein 5

Gene Name URL

PDCD5

Nucleotide Accession Number

NM_004708

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL17 (C-C motif chemokine 17) ELISA Kit
EKF58158 96 Tests

Human CCL17 (C-C motif chemokine 17) ELISA Kit

Sign In for Pricing
View Details
S100A3 (NM_002960) Human Tagged ORF Clone
RG202117 10 µg

S100A3 (NM_002960) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)
MBS7033448-01 0.02 mg

Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)
MBS7033448-02 0.1 mg

Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)
MBS7033448-03 5x 0.1 mg

Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Sign In for Pricing
View Details
Naphthaleneacetic Acid (NAA)
CN-N001-25GM 25 g

Naphthaleneacetic Acid (NAA)

Sign In for Pricing
View Details