Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP20 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cilia and flagella associated protein 20

Gene Aliases

Basal body up-regulated protein 22; BUG22; C16orf80; cilia- and flagella-associated protein 20; EVORF; flagellar associated protein 20 homolog; fSAP23; functional spliceosome-associated protein 23; gene trap locus 3; GTL3; transcription factor IIB; UPF0468 protein C16orf80.

Gene ID

29105

Accession Number

NP_037374

Reactivity

Homo sapiens|Human

Target

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207) . Required for axonemal microtubules polyglutamylation (PubMed:24414207) .

Type

Protein

Source

E.coli

Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CFAP20

Protein Name

Cilia- and flagella-associated protein 20

Gene Name URL

CFAP20

Nucleotide Accession Number

NM_013242

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-01 0.02 mg (E-Coli)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-02 0.1 mg (E-Coli)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-03 0.02 mg (Yeast)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-04 0.1 mg (Yeast)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-05 0.02 mg (Baculovirus)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)
MBS1119618-06 0.02 mg (Mammalian-Cell)

Recombinant Sulfolobus islandicus 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details