Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ribosomal protein S27

Gene Aliases

40S ribosomal protein S27; DBA17; metallopanstimulin 1; metallopan-stimulin 1; MPS1; MPS-1; S27; small ribosomal subunit protein eS27.

Gene ID

6232

Accession Number

NP_001021

Reactivity

Homo sapiens|Human

Target

Component of the small ribosomal subunit (PubMed:8706699) . Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902) .

Type

Protein

Source

E.coli

Sequence

PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RPS27

Protein Name

40S ribosomal protein S27

Gene Name URL

RPS27

Nucleotide Accession Number

NM_001030

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nme4 ORF Vector (Mouse) (pORF)
ORF051469 1.0 µg DNA

Nme4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit luteotropic hormone, LH ELISA Kit
MBS9310504 Inquire

Rabbit luteotropic hormone, LH ELISA Kit

Sign In for Pricing
View Details
ExuT Antibody
orb814992 2 mg

ExuT Antibody

Sign In for Pricing
View Details
4932412H11Rik Protein Vector (Mouse) (pPM-C-HA)
PV149588 500 ng

4932412H11Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 750)
MBS6300794-01 0.1 mL

GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 750)

Sign In for Pricing
View Details
GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 750)
MBS6300794-02 5x 0.1 mL

GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 750)

Sign In for Pricing
View Details